NFIB anticorps

N° du produit ABIN5708262

Détail du produit anti-NFIB anticorps

Antigène: NFIB (Nuclear Factor I/B (NFIB))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NFIB est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids ELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR were used as the immunogen for the NFIB antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the NFIB antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL, IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the NFIB antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur NFIB

Antigène: NFIB (Nuclear Factor I/B (NFIB))

Autre désignation: NFIB / Nuclear factor 1 B-type (NFIB Produits)

Synonymes: anticorps NFIB, anticorps nf1-b1, anticorps CTF, anticorps HMGIC/NFIB, anticorps NF-I/B, anticorps NF1-B, anticorps NFI-B, anticorps NFI-RED, anticorps NFIB2, anticorps NFIB3, anticorps 6720429L07Rik, anticorps E030026I10Rik, anticorps nuclear factor I B, anticorps nuclear factor 1 B-type, anticorps nuclear factor I B L homeolog, anticorps nuclear factor I/B, anticorps NFIB, anticorps LOC100221557, anticorps nfib.L, anticorps Nfib

Sujet: Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. [UniProt]

UniProt: O00712