Regucalcin anticorps
-
- Antigène Voir toutes Regucalcin (RGN) Anticorps
- Regucalcin (RGN)
- Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Regucalcin est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity purified
- Immunogène
- Amino acids YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD were used as the immunogen for the Regucalcin antibody.
- Isotype
- IgG
- Top Product
- Discover our top product RGN Anticorps primaire
-
-
- Indications d'application
- Optimal dilution of the Regucalcin antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the Regucalcin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- Regucalcin (RGN)
- Autre désignation
- Regucalcin (RGN Produits)
- Synonymes
- anticorps CG1803, anticorps Dmel\\CG1803, anticorps Regucalcin, anticorps T1, anticorps GNL, anticorps zgc:92078, anticorps smp30, anticorps xsmp-30, anticorps xsmp30, anticorps DyakGE16489, anticorps dyak_GLEANR_17905, anticorps GE16489, anticorps regucalcin, anticorps SMP30, anticorps AI265316, anticorps RC, anticorps rgn-A, anticorps Rc, anticorps Reguc, anticorps SMP-30, anticorps CG1803 gene product from transcript CG1803-RA, anticorps regucalcin, anticorps GE16489 gene product from transcript GE16489-RB, anticorps regucalcin (senescence marker protein-30), anticorps regucalcin L homeolog, anticorps regucalcin, anticorps rgn, anticorps LOC465598, anticorps RGN, anticorps Dyak\regucalcin, anticorps Rgn, anticorps rgn.L
- Sujet
- Regucalcin is a protein that in humans is encoded by the RGN gene. The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23.
- UniProt
- Q15493
-