SP6 anticorps
-
- Antigène Voir toutes SP6 Anticorps
- SP6 (Sp6 Transcription Factor (SP6))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SP6 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity purified
- Immunogène
- Amino acids QPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPH from the human protein were used as the immunogen for the SP6 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product SP6 Anticorps primaire
-
-
- Indications d'application
- Optimal dilution of the SP6 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the SP6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- SP6 (Sp6 Transcription Factor (SP6))
- Autre désignation
- SP6 / Transcription factor Sp6 (SP6 Produits)
- Synonymes
- anticorps xsp6, anticorps MGC131081, anticorps EPFN, anticorps EPIPROFIN, anticorps KLF14, anticorps 1110025J03Rik, anticorps AA591031, anticorps AI592962, anticorps Epfn, anticorps Klf14, anticorps Sp6 transcription factor, anticorps Sp5 transcription factor L homeolog, anticorps trans-acting transcription factor 6, anticorps SP6, anticorps sp5.L, anticorps Sp6
- Sujet
- SP6 belongs to a family of transcription factors that contain 3 classical zinc finger DNA-binding domains consisting of a zinc atom tetrahedrally coordinated by 2 cysteines and 2 histidines (C2H2 motif). These transcription factors bind to GC-rich sequences and related GT and CACCC boxes. By somatic cell hybrid analysis and FISH, he SP6 gene is mapped t to chromosome 17q21.3-q22.
- UniProt
- Q3SY56
-