CPA anticorps

N° du produit ABIN5708326

Détail du produit anti-CPA anticorps

Antigène: CPA (Carboxypeptidase A (CPA))

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPA est non-conjugé

Application: Western Blotting (WB)

Réactivité croisée (Details): Expected species reactivity: Human

Purification: Antigen affinity purified

Immunogène: Amino acids KRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLD from the human protein were used as the immunogen for the Carboxypeptidase A antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Carboxypeptidase A antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Carboxypeptidase A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur CPA

Antigène: CPA (Carboxypeptidase A (CPA))

Autre désignation: Carboxypeptidase A (CPA Produits)

Sujet: Carboxypeptidase A1 is an enzyme that in humans is encoded by the CPA1 gene. This gene encodes a member of the carboxypeptidase A family of zinc metalloproteases. This enzyme is produced in the pancreas and preferentially cleaves C-terminal branched-chain and aromatic amino acids from dietary proteins. This gene and several family members are present in a gene cluster on chromosome 7. Mutations in this gene may be linked to chronic pancreatitis, while elevated protein levels may be associated with pancreatic cancer.

UniProt: P15085