GFI1 anticorps

N° du produit ABIN5708405

Détail du produit anti-GFI1 anticorps

Antigène: GFI1 (Growth Factor Independent 1 (GFI1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GFI1 est non-conjugé

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids NLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH were used as the immunogen for the GFI1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the GFI1 antibody should be determined by the researcher.\. IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the GFI1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur GFI1

Antigène: GFI1 (Growth Factor Independent 1 (GFI1))

Autre désignation: GFI1 (GFI1 Produits)

Synonymes: anticorps AW495828, anticorps Gfi-1, anticorps Pal-1, anticorps Pal1, anticorps GFI1, anticorps GFI-1, anticorps GFI1A, anticorps SCN2, anticorps ZNF163, anticorps growth factor independent 1, anticorps growth factor independent 1 transcriptional repressor, anticorps Gfi1, anticorps GFI1

Sujet: Zinc finger protein Gfi-1 is a protein that in humans is encoded by the GFI1 gene. This gene encodes a nuclear zinc finger protein that functions as a transcriptional repressor. This protein plays a role in diverse developmental contexts, including hematopoiesis and oncogenesis. It functions as part of a complex along with other cofactors to control histone modifications that lead to silencing of the target gene promoters. Mutations in this gene cause autosomal dominant severe congenital neutropenia, and also dominant nonimmune chronic idiopathic neutropenia of adults, which are heterogeneous hematopoietic disorders that cause predispositions to leukemias and infections. Multiple alternatively spliced variants, encoding the same protein, have been identified for this gene.

UniProt: Q99684