CEP68 anticorps

N° du produit ABIN5708411

Détail du produit anti-CEP68 anticorps

Antigène: CEP68 (Centrosomal Protein 68kDa (CEP68))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CEP68 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID were used as the immunogen for the CEP68 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the CEP68 antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the CEP68 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur CEP68

Antigène: CEP68 (Centrosomal Protein 68kDa (CEP68))

Autre désignation: CEP68 (CEP68 Produits)

Synonymes: anticorps RGD1309101, anticorps 6030463E10Rik, anticorps AI481761, anticorps BC027174, anticorps Kiaa0582, anticorps KIAA0582, anticorps centrosomal protein 68, anticorps Cep68, anticorps CEP68

Sujet: Centrosomal protein of 68 kDa is a protein that in humans is encoded by the CEP68 gene. It is mapped to chromosome 2. CEP68 is required for centrosome cohesion. It decorates fibres emanating from the proximal ends of centrioles. CEP68 and Rootletin depend both on each other for centriole association, and both also require CEP250 for their function.

UniProt: Q76N32

Pathways: SARS-CoV-2 Protein Interactome