FZD4 anticorps
-
- Antigène Voir toutes FZD4 Anticorps
- FZD4 (Frizzled Family Receptor 4 (FZD4))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FZD4 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity purified
- Immunogène
- Amino acids QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY from the human protein were used as the immunogen for the FZD4 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product FZD4 Anticorps primaire
-
-
- Indications d'application
- Optimal dilution of the FZD4 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the FZD4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- FZD4 (Frizzled Family Receptor 4 (FZD4))
- Autre désignation
- Frizzled 4 / FZD4 (FZD4 Produits)
- Synonymes
- anticorps CG4626, anticorps DFz4, anticorps Dfz4, anticorps Dm Fz4, anticorps Dmel\\CG4626, anticorps Fz4, anticorps anon-WO0170980.10, anticorps anon-WO0170980.11, anticorps fz1, anticorps zg01, anticorps CD344, anticorps EVR1, anticorps FEVR, anticorps FZD4S, anticorps Fz-4, anticorps FzE4, anticorps GPCR, anticorps hFz4, anticorps frizzled4, anticorps fz4, anticorps FZ-4, anticorps frizzled 4, anticorps frizzled class receptor 4, anticorps frizzled-4, anticorps frizzled class receptor 4 S homeolog, anticorps fz4, anticorps fzd4, anticorps Tsp_10376, anticorps FZD4, anticorps Fzd4, anticorps fzd4.S
- Sujet
- Frizzled-4 is a protein that in humans is encoded by the FZD4 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.
- UniProt
- Q9ULV1
- Pathways
- Signalisation WNT, Hormone Transport, Sensory Perception of Sound
-