NPC2 anticorps

N° du produit ABIN5708461

Détail du produit anti-NPC2 anticorps

Antigène: NPC2 (Niemann-Pick Disease, Type C2 (NPC2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NPC2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids KSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVS from the human protein were used as the immunogen for the NPC2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the NPC2 antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the NPC2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur NPC2

Antigène: NPC2 (Niemann-Pick Disease, Type C2 (NPC2))

Autre désignation: NPC2 / Niemann Pick C2 (NPC2 Produits)

Synonymes: anticorps 2700012J19Rik, anticorps AA408070, anticorps AU045843, anticorps HE1, anticorps EDDM1, anticorps re1, anticorps CE1, anticorps EPI-1, anticorps cb292, anticorps sb:cb292, anticorps NPC intracellular cholesterol transporter 2, anticorps Niemann-Pick disease, type C2, anticorps Npc2, anticorps NPC2, anticorps npc2

Sujet: NPC2 is a protein associated with Niemann-Pick disease, type C. This gene is mapped to chromosome 14q24.3. It encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy.

UniProt: P61916

Pathways: SARS-CoV-2 Protein Interactome