DEFB4A anticorps (AA 4-41)

N° du produit ABIN604437

Détail du produit anti-DEFB4A anticorps

Antigène: DEFB4A (DEFB4) (Defensin, beta 4A (DEFB4))

Épitope: AA 4-41

Reactivité: Humain

Hôte: Mouton

Clonalité: Polyclonal

Conjugué: Cet anticorp DEFB4A est non-conjugé

Application: ELISA, Radioimmunoassay (RIA)

Specificité: Recognizes human beta-Defensin 2 (epitope: aa 4-41).

Homologie: Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla (100%) Gibbon, Monkey (97%) Orangutan (81%).

Purification: Protein G purified

Immunogène: Synthetic human -Defensin 2 (aa 4-41)(DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla (100%), Gibbon, Monkey (97%), Orangutan (81%).

Isotype: IgG

Information d'application

Indications d'application: Approved: ELISA (1:5000), RIA

Usage: Suitable for use in ELISA and RIA. ELISA: 1:5000.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Sterile buffer or distilled water

Concentration: Lot specific

Buffer: Lyophilized from 50 mM Tris,  pH 7.4

Stock: -20 °C

Stockage commentaire: Lyophilized powder may be stored at -20°C. Aliquot and store at -20°C. Reconstituted product is stable for 1 year at -20°C.

Détails sur DEFB4A

Antigène: DEFB4A (DEFB4) (Defensin, beta 4A (DEFB4))

Autre désignation: DEFB4A / DEFB2 (DEFB4 Produits)

Synonymes: anticorps BD-2, anticorps DEFB-2, anticorps DEFB102, anticorps DEFB2, anticorps DEFB4, anticorps HBD-2, anticorps SAP1, anticorps BD2, anticorps DEFB4P, anticorps THP2, anticorps defensin beta 4A, anticorps defensin beta 2, anticorps defensin beta 1, anticorps avian beta-defensin 4, anticorps defensin, beta 4A, anticorps beta-defensin 2, anticorps defensin beta 4, anticorps beta defensin 2, anticorps DEFB4A, anticorps Defb2, anticorps DEFB1, anticorps AvBD4, anticorps THP2, anticorps defb4, anticorps SBD2

Sujet: Name/Gene ID: DEFB4A

Synonyms: DEFB4A, Beta-defensin 2, Beta-defensin 4A, DEFB-2, DEFB102, Defensin, beta 2, Defensin, beta 4, Defensin, beta 4A, DEFB4, DEFB2, HBD-2, Skin-antimicrobial peptide 1, BD-2, SAP1

ID gène: 1673