RORA anticorps (N-Term)
-
- Antigène Voir toutes RORA Anticorps
- RORA (RAR-Related Orphan Receptor A (RORA))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RORA est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RORA antibody was raised against the N terminal of RORA
- Purification
- Purified
- Immunogène
- RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC
- Top Product
- Discover our top product RORA Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RORA Blocking Peptide, catalog no. 33R-1692, is also available for use as a blocking control in assays to test for specificity of this RORA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RORA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RORA (RAR-Related Orphan Receptor A (RORA))
- Autre désignation
- RORA (RORA Produits)
- Synonymes
- anticorps ror1, anticorps ror2, anticorps ror3, anticorps rzra, anticorps nr1f1, anticorps MGC146531, anticorps NR1F1, anticorps ROR1, anticorps ROR2, anticorps ROR3, anticorps RZR-ALPHA, anticorps RZRA, anticorps RORalpha-B, anticorps gb:dq017624, anticorps rora2, anticorps 9530021D13Rik, anticorps Nr1f1, anticorps nmf267, anticorps sg, anticorps staggerer, anticorps tmgc26, anticorps RORalpha1, anticorps RAR related orphan receptor A, anticorps RAR-related orphan receptor A, anticorps RAR-related orphan receptor A, paralog a, anticorps RAR-related orphan receptor alpha, anticorps RORA, anticorps rora, anticorps Rora, anticorps roraa
- Sujet
- The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.
- Poids moléculaire
- 62 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha
-