PGS1 anticorps (C-Term)
-
- Antigène Voir toutes PGS1 Anticorps
- PGS1 (Phosphatidylglycerophosphate Synthase 1 (PGS1))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PGS1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PGS1 antibody was raised against the C terminal of PGS1
- Purification
- Purified
- Immunogène
- PGS1 antibody was raised using the C terminal of PGS1 corresponding to a region with amino acids RVQLQEYWRRGWTFHAKGLWLYLAGSSLPCLTLIGSPNFGYRSVHRDLEA
- Top Product
- Discover our top product PGS1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PGS1 Blocking Peptide, catalog no. 33R-8255, is also available for use as a blocking control in assays to test for specificity of this PGS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PGS1 (Phosphatidylglycerophosphate Synthase 1 (PGS1))
- Autre désignation
- PGS1 (PGS1 Produits)
- Synonymes
- anticorps 2610019F11Rik, anticorps 4933424M23Rik, anticorps SAF, anticorps RGD1305052, anticorps phosphatidylglycerophosphate synthase 1, anticorps phosphatidylglycerophosphate synthase 1 S homeolog, anticorps PGS1, anticorps Pgs1, anticorps pgs1.S, anticorps pgs1
- Sujet
- PGS1 functions in the biosynthesis of the anionic phospholipids phosphatidylglycerol and cardiolipin.
- Poids moléculaire
- 60 kDa (MW of target protein)
-