ECHDC3 anticorps (N-Term)

N° du produit ABIN629586

Détail du produit anti-ECHDC3 anticorps

Antigène: ECHDC3 (Enoyl CoA Hydratase Domain Containing 3 (ECHDC3))

Épitope: N-Term

Reactivité: Rat, Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ECHDC3 est non-conjugé

Application: Western Blotting (WB)

Specificité: ECHDC3 antibody was raised against the N terminal of ECHDC3

Purification: Purified

Immunogène: ECHDC3 antibody was raised using the N terminal of ECHDC3 corresponding to a region with amino acids SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDY

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ECHDC3 Blocking Peptide, catalog no. 33R-8576, is also available for use as a blocking control in assays to test for specificity of this ECHDC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ECHDC3

Antigène: ECHDC3 (Enoyl CoA Hydratase Domain Containing 3 (ECHDC3))

Autre désignation: ECHDC3 (ECHDC3 Produits)

Synonymes: anticorps 2310005D12Rik, anticorps AI662097, anticorps echdc3, anticorps enoyl-CoA hydratase domain containing 3, anticorps enoyl CoA hydratase domain containing 3, anticorps enoyl-CoA hydratase domain containing 3 L homeolog, anticorps enoyl Coenzyme A hydratase domain containing 3, anticorps ECHDC3, anticorps Echdc3, anticorps echdc3.L, anticorps echdc3

Sujet: ECHDC3 possesses catalytic activity.

Poids moléculaire: 40 kDa (MW of target protein)