USP16 anticorps (N-Term)

N° du produit ABIN629587

Détail du produit anti-USP16 anticorps

Antigène: USP16 (Ubiquitin Specific Peptidase 16 (USP16))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp USP16 est non-conjugé

Application: Western Blotting (WB)

Specificité: USP16 antibody was raised against the N terminal of USP16

Purification: Purified

Immunogène: USP16 antibody was raised using the N terminal of USP16 corresponding to a region with amino acids CKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRS

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

USP16 Blocking Peptide, catalog no. 33R-1726, is also available for use as a blocking control in assays to test for specificity of this USP16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur USP16

Antigène: USP16 (Ubiquitin Specific Peptidase 16 (USP16))

Autre désignation: USP16 (USP16 Produits)

Synonymes: anticorps ubp-m, anticorps USP16, anticorps UBP-M, anticorps 1200004E02Rik, anticorps 2810483I07Rik, anticorps 6330514E22Rik, anticorps UBPM, anticorps si:ch211-238e22.5, anticorps si:dkey-121n8.2, anticorps wu:fc76b02, anticorps wu:fc76b08, anticorps universal stress protein, anticorps ubiquitin specific peptidase 16, anticorps ubiquitin specific peptidase 16 L homeolog, anticorps usp16, anticorps USP16, anticorps Usp16, anticorps usp16.L

Sujet: USP16 is a deubiquitinating enzyme that is phosphorylated at the onset of mitosis and then dephosphorylated at the metaphase/anaphase transition. It can deubiquitinate H2A, one of two major ubiquitinated proteins of chromatin, in vitro and a mutant form of the protein was shown to block cell division.

Poids moléculaire: 44 kDa (MW of target protein)