GMPR2 anticorps (C-Term)

N° du produit ABIN629588

Détail du produit anti-GMPR2 anticorps

Antigène: GMPR2 (Guanosine Monophosphate Reductase 2 (GMPR2))

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GMPR2 est non-conjugé

Application: Western Blotting (WB)

Specificité: GMPR2 antibody was raised against the C terminal of GMPR2

Purification: Purified

Immunogène: GMPR2 antibody was raised using the C terminal of GMPR2 corresponding to a region with amino acids GAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGV

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GMPR2 Blocking Peptide, catalog no. 33R-3152, is also available for use as a blocking control in assays to test for specificity of this GMPR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMPR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GMPR2

Antigène: GMPR2 (Guanosine Monophosphate Reductase 2 (GMPR2))

Autre désignation: GMPR2 (GMPR2 Produits)

Synonymes: anticorps MGC81876, anticorps wu:fb63f02, anticorps zgc:136869, anticorps 1810008P16Rik, anticorps 5730544D12Rik, anticorps AA959850, anticorps guanosine monophosphate reductase 2 S homeolog, anticorps guanosine monophosphate reductase 2, anticorps gmpr2.S, anticorps guaC, anticorps gmpr2, anticorps GMPR2, anticorps Gmpr2

Sujet: GMPR2 catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. It plays a role in modulating cellular differentiation.

Poids moléculaire: 20 kDa (MW of target protein)