METTL7A anticorps (N-Term)

N° du produit ABIN629594

Détail du produit anti-METTL7A anticorps

Antigène: METTL7A (Methyltransferase Like 7A (METTL7A))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp METTL7A est non-conjugé

Application: Western Blotting (WB)

Specificité: METTL7 A antibody was raised against the N terminal of METTL7

Purification: Purified

Immunogène: METTL7 A antibody was raised using the N terminal of METTL7 corresponding to a region with amino acids MASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPN

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

METTL7A Blocking Peptide, catalog no. 33R-5748, is also available for use as a blocking control in assays to test for specificity of this METTL7A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur METTL7A

Antigène: METTL7A (Methyltransferase Like 7A (METTL7A))

Autre désignation: METTL7A (METTL7A Produits)

Synonymes: anticorps AAM-B, anticorps 2210414H16Rik, anticorps 3300001H21Rik, anticorps Aam-B, anticorps Mettl7a, anticorps UbiE1, anticorps RGD1308407, anticorps MGC82719, anticorps zgc:153889, anticorps MGC145311, anticorps DKFZp459L026, anticorps methyltransferase like 7A, anticorps methyltransferase like 7A1, anticorps methyltransferase like 7A L homeolog, anticorps METTL7A, anticorps Mettl7a1, anticorps Mettl7a, anticorps mettl7a.L, anticorps mettl7a

Sujet: METTL7A is thought to be a methyltransferase enzyme.

Poids moléculaire: 20 kDa (MW of target protein)