PRMT5 anticorps (N-Term)
-
- Antigène Voir toutes PRMT5 Anticorps
- PRMT5 (Protein Arginine Methyltransferase 5 (PRMT5))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PRMT5 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- PRMT5 antibody was raised against the N terminal of PRMT5
- Purification
- Purified
- Immunogène
- PRMT5 antibody was raised using the N terminal of PRMT5 corresponding to a region with amino acids FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS
- Top Product
- Discover our top product PRMT5 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PRMT5 Blocking Peptide, catalog no. 33R-2864, is also available for use as a blocking control in assays to test for specificity of this PRMT5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PRMT5 (Protein Arginine Methyltransferase 5 (PRMT5))
- Autre désignation
- PRMT5 (PRMT5 Produits)
- Sujet
- PRMT5 methylates specific arginine residues in the small nuclear ribonucleoproteins Sm D1 and Sm D3 to monomethylarginine and to symmetrical dimethylarginines (sDMAs). It methylates SUPT5H. PRMT5 plays a role in the assembly of snRNP core particles and may play a role in cytokine-activated transduction pathways. It negatively regulates cyclin E1 promoter activity and cellular proliferation and May regulate the SUPT5H transcriptional elongation properties. It may be part of a pathway that is connected to a chloride current, possibly through cytoskeletal rearrangement. PRMT5 methylates histone H2A/H4 'Arg-3' during germ cell development and methylates histone H3 'Arg-8', which may repress transcription.
- Poids moléculaire
- 68 kDa (MW of target protein)
- Pathways
- Chromatin Binding, Regulation of Muscle Cell Differentiation, Ribonucleoprotein Complex Subunit Organization, Skeletal Muscle Fiber Development
-