PEBP1 anticorps (C-Term)
-
- Antigène Voir toutes PEBP1 Anticorps
- PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PEBP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PEBP1 antibody was raised against the C terminal of PEBP1
- Purification
- Purified
- Immunogène
- PEBP1 antibody was raised using the C terminal of PEBP1 corresponding to a region with amino acids LSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK
- Top Product
- Discover our top product PEBP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PEBP1 Blocking Peptide, catalog no. 33R-5442, is also available for use as a blocking control in assays to test for specificity of this PEBP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEBP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))
- Autre désignation
- PEBP1 (PEBP1 Produits)
- Synonymes
- anticorps HCNP, anticorps HCNPpp, anticorps PBP, anticorps PEBP, anticorps PEBP-1, anticorps RKIP, anticorps pbp, anticorps hcnp, anticorps pebp, anticorps rkip, anticorps Pbp, anticorps Pbp1, anticorps Pbpr, anticorps Rkip, anticorps PEBP1, anticorps BcDNA:LP12095, anticorps CG18594, anticorps Dmel\\CG18594, anticorps T2, anticorps zgc:56033, anticorps zgc:76942, anticorps phosphatidylethanolamine binding protein 1, anticorps phosphatidylethanolamine binding protein 1 L homeolog, anticorps phosphatidylethanolamine-binding protein, anticorps phosphatidylethanolamine-binding protein,putative, anticorps Phosphatidylethanolamine-binding protein 1, anticorps PEBP1, anticorps pebp1, anticorps Pebp1, anticorps pebp1.L, anticorps RR_RS07785, anticorps PVX_235290, anticorps PVX_123630, anticorps PKH_143640, anticorps EAM_1207
- Sujet
- PEBP1 binds ATP, opioids and phosphatidylethanolamine. It has lower affinity for phosphatidylinositol and phosphatidylcholine. It is also a serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase.
- Poids moléculaire
- 21 kDa (MW of target protein)
- Pathways
- Feeding Behaviour
-