PRMT2 anticorps (N-Term)

N° du produit ABIN629611

Détail du produit anti-PRMT2 anticorps

Antigène: PRMT2 (Protein Arginine Methyltransferase 2 (PRMT2))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRMT2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: PRMT2 antibody was raised against the N terminal of PRMT2

Purification: Purified

Immunogène: PRMT2 antibody was raised using the N terminal of PRMT2 corresponding to a region with amino acids ESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILIL

Information d'application

Indications d'application: WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRMT2 Blocking Peptide, catalog no. 33R-2742, is also available for use as a blocking control in assays to test for specificity of this PRMT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRMT2

Antigène: PRMT2 (Protein Arginine Methyltransferase 2 (PRMT2))

Autre désignation: PRMT2 (PRMT2 Produits)

Synonymes: anticorps PRMT2, anticorps DKFZp459N1919, anticorps HRMT1L1, anticorps Hrmt1l1, anticorps AI504737, anticorps protein arginine methyltransferase 2, anticorps protein arginine methyltransferase 2 L homeolog, anticorps protein arginine N-methyltransferase 2, anticorps PRMT2, anticorps Prmt2, anticorps prmt2.L

Sujet: The protein arginine methyltransferases (PRMTs) include a family of proteins with related putative methyltransferase domains that modify chromatin and regulate cellular transcription. PRMT2 inhibits NF-kappaB-dependent transcription and promotes apoptosis and it exerts this effect by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding. PRMT2 also rendered cells susceptible to apoptosis by cytokines or cytotoxic drugs, likely due to its effects on NF-kappaB.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Nuclear Hormone Receptor Binding