PEX3 anticorps (N-Term)

N° du produit ABIN629613

Détail du produit anti-PEX3 anticorps

Antigène: PEX3 (Peroxisomal Biogenesis Factor 3 (PEX3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PEX3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: PEX3 antibody was raised against the N terminal of PEX3

Purification: Purified

Immunogène: PEX3 antibody was raised using the N terminal of PEX3 corresponding to a region with amino acids KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVLSMLPTLREAL

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PEX3 Blocking Peptide, catalog no. 33R-4740, is also available for use as a blocking control in assays to test for specificity of this PEX3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PEX3

Antigène: PEX3 (Peroxisomal Biogenesis Factor 3 (PEX3))

Autre désignation: PEX3 (PEX3 Produits)

Synonymes: anticorps DDBDRAFT_0204086, anticorps DDBDRAFT_0238047, anticorps DDB_0204086, anticorps DDB_0238047, anticorps zgc:56313, anticorps PBD10A, anticorps TRG18, anticorps Peroxin-3, anticorps 1700014F15Rik, anticorps 2810027F19Rik, anticorps 2900010N04Rik, anticorps peroxisomal biogenesis factor 3, anticorps peroxin 3, anticorps peroxisomal biogenesis factor 3 L homeolog, anticorps LOC692959, anticorps CpipJ_CPIJ013204, anticorps pex3, anticorps PEX3, anticorps pex3.L, anticorps Pex3

Sujet: PEX3 is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. As a docking factor for PEX19, it is necessary for the import of peroxisomal membrane proteins in the peroxisomes.

Poids moléculaire: 42 kDa (MW of target protein)