SWAP70 anticorps (N-Term)

N° du produit ABIN629614

Détail du produit anti-SWAP70 anticorps

Antigène: SWAP70 (SWAP Switching B-Cell Complex 70kDa Subunit (SWAP70))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SWAP70 est non-conjugé

Application: Western Blotting (WB)

Specificité: SWAP70 antibody was raised against the N terminal of SWAP70

Purification: Purified

Immunogène: SWAP70 antibody was raised using the N terminal of SWAP70 corresponding to a region with amino acids ALEEHFRDDDEGPVSNQGYMPYLNRFILEKVQDNFDKIEFNRMCWTLCVK

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SWAP70 Blocking Peptide, catalog no. 33R-1326, is also available for use as a blocking control in assays to test for specificity of this SWAP70 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SWAP70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SWAP70

Antigène: SWAP70 (SWAP Switching B-Cell Complex 70kDa Subunit (SWAP70))

Autre désignation: SWAP70 (SWAP70 Produits)

Synonymes: anticorps SWAP-70, anticorps 70kDa, anticorps AV235546, anticorps HSPC321, anticorps swap70b, anticorps zgc:63599, anticorps switching B-cell complex subunit SWAP70, anticorps SWA-70 protein, anticorps SWAP switching B-cell complex 70, anticorps SWAP switching B-cell complex 70kDa subunit, anticorps switching B-cell complex subunit SWAP70a, anticorps SWAP70, anticorps Swap70, anticorps swap70, anticorps swap70a

Sujet: Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which, independently of RAS, transduces signals from tyrosine kinase receptors to RAC. SWAP70 also mediates signaling of membrane ruffling. It regulates the actin cytoskeleton as an effector or adapter protein in response to agonist stimulated phosphatidylinositol (3,4)-bisphosphate production and cell protrusion.

Poids moléculaire: 69 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response