NMNAT1 anticorps (N-Term)

N° du produit ABIN629615

Détail du produit anti-NMNAT1 anticorps

Antigène: NMNAT1 (Nicotinamide Nucleotide Adenylyltransferase 1 (NMNAT1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NMNAT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NMNAT1 antibody was raised against the N terminal of NMNAT1

Purification: Purified

Immunogène: NMNAT1 antibody was raised using the N terminal of NMNAT1 corresponding to a region with amino acids PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NMNAT1 Blocking Peptide, catalog no. 33R-7409, is also available for use as a blocking control in assays to test for specificity of this NMNAT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMNAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NMNAT1

Antigène: NMNAT1 (Nicotinamide Nucleotide Adenylyltransferase 1 (NMNAT1))

Autre désignation: NMNAT1 (NMNAT1 Produits)

Synonymes: anticorps id:ibd5068, anticorps im:7144541, anticorps zgc:110243, anticorps LCA9, anticorps NMNAT, anticorps PNAT1, anticorps 2610529L11Rik, anticorps 5730441G13Rik, anticorps D4Cole1e, anticorps nmnat, anticorps nicotinamide mononucleotide adenylyltransferase 1, anticorps nicotinamide nucleotide adenylyltransferase 1, anticorps CpipJ_CPIJ015320, anticorps PTRG_06486, anticorps nmnat1, anticorps NMNAT1, anticorps Nmnat1

Sujet: The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD.

Poids moléculaire: 32 kDa (MW of target protein)