ANKRD11 anticorps (N-Term)
-
- Antigène Voir toutes ANKRD11 Anticorps
- ANKRD11 (Ankyrin Repeat Domain 11 (ANKRD11))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ANKRD11 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- ANKRD11 antibody was raised against the N terminal of ANKRD11
- Purification
- Purified
- Immunogène
- ANKRD11 antibody was raised using the N terminal of ANKRD11 corresponding to a region with amino acids KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR
- Top Product
- Discover our top product ANKRD11 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ANKRD11 Blocking Peptide, catalog no. 33R-4627, is also available for use as a blocking control in assays to test for specificity of this ANKRD11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ANKRD11 (Ankyrin Repeat Domain 11 (ANKRD11))
- Autre désignation
- ANKRD11 (ANKRD11 Produits)
- Synonymes
- anticorps ANCO-1, anticorps ANCO1, anticorps LZ16, anticorps T13, anticorps 2410104C19Rik, anticorps 3010027A04Rik, anticorps 6330578C09Rik, anticorps 9530048I21Rik, anticorps AA930108, anticorps Gm176, anticorps Yod, anticorps ANKRD11, anticorps wu:fc59e05, anticorps wu:fi04c06, anticorps ankyrin repeat domain 11, anticorps ankyrin repeat domain 11 L homeolog, anticorps ANKRD11, anticorps Ankrd11, anticorps ankrd11.L, anticorps ankrd11
- Sujet
- ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.
- Poids moléculaire
- 298 kDa (MW of target protein)
-