SETD7 anticorps
-
- Antigène Voir toutes SETD7 Anticorps
- SETD7 (SET Domain Containing (Lysine Methyltransferase) 7 (SETD7))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SETD7 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- SETD7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAF
- Top Product
- Discover our top product SETD7 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SETD7 Blocking Peptide, catalog no. 33R-7322, is also available for use as a blocking control in assays to test for specificity of this SETD7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SETD7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SETD7 (SET Domain Containing (Lysine Methyltransferase) 7 (SETD7))
- Autre désignation
- SETD7 (SETD7 Produits)
- Synonymes
- anticorps KMT7, anticorps SET7, anticorps SET7/9, anticorps SET9, anticorps set7, anticorps zgc:101860, anticorps zgc:92330, anticorps 1600028F23Rik, anticorps H3K4MT, anticorps Set7, anticorps Set7/9, anticorps mKIAA1717, anticorps SET domain containing lysine methyltransferase 7, anticorps SET domain containing (lysine methyltransferase) 7, anticorps SETD7, anticorps setd7, anticorps Setd7
- Sujet
- SETD7 is a histone methyltransferase that specifically monomethylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. It plays a central role in the transcriptional activation of genes such as collagenase or insulin. It is recruited by IPF1/PDX-1 to the insulin promoter, leading to activate transcription. It has also methyltransferase activity toward non-histone proteins such as p53/TP53, TAF10, and possibly TAF7 by recognizing and binding the [KR]-[STA]-K in substrate proteins.
- Poids moléculaire
- 41 kDa (MW of target protein)
-