CDY1 anticorps (C-Term)

N° du produit ABIN629620

Détail du produit anti-CDY1 anticorps

Antigène: CDY1 (Chromodomain Protein, Y-Linked, 1 (CDY1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDY1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CDY1 antibody was raised against the C terminal of CDY1

Purification: Purified

Immunogène: CDY1 antibody was raised using the C terminal of CDY1 corresponding to a region with amino acids FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDY1 Blocking Peptide, catalog no. 33R-3023, is also available for use as a blocking control in assays to test for specificity of this CDY1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDY1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDY1

Antigène: CDY1 (Chromodomain Protein, Y-Linked, 1 (CDY1))

Autre désignation: CDY1 (CDY1 Produits)

Synonymes: anticorps CDY, anticorps CDY1A, anticorps chromodomain Y-linked 1, anticorps CDY1

Sujet: CDY1 containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein.

Poids moléculaire: 62 kDa (MW of target protein)