PRP19 anticorps

N° du produit ABIN629621

Détail du produit anti-PRP19 anticorps

Antigène: PRP19 (PRPF19) (Pre-mRNA Processing Factor 19 (PRPF19))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRP19 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: PRPF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHP

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRPF19 Blocking Peptide, catalog no. 33R-9720, is also available for use as a blocking control in assays to test for specificity of this PRPF19 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRP19

Antigène: PRP19 (PRPF19) (Pre-mRNA Processing Factor 19 (PRPF19))

Autre désignation: PRPF19 (PRPF19 Produits)

Synonymes: anticorps NMP200, anticorps fb18f09, anticorps zgc:56158, anticorps wu:fb18f09, anticorps nmp200, anticorps PRP19, anticorps PSO4, anticorps SNEV, anticorps UBOX4, anticorps hPSO4, anticorps Prp19, anticorps nmp-200, anticorps AA617263, anticorps AL024362, anticorps D19Wsu55e, anticorps Snev, anticorps pre-mRNA processing factor 19, anticorps pre-mRNA processing factor 19 L homeolog, anticorps prpf19, anticorps prpf19.L, anticorps PRPF19, anticorps Prpf19

Sujet: PRPF19 plays a role in DNA double-strand break (DSB) repair and pre-mRNA splicing reaction. It binds double-stranded DNA in a sequence-nonspecific manner. PRPF19 acts as a structural component of the nuclear framework. It may also serve as a support for spliceosome binding and activity. It is essential for spliceosome assembly in a oligomerization-dependent manner and might also be important for spliceosome stability. It also may have E3 ubiquitin ligase activity.

Poids moléculaire: 55 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization