ZNF19 anticorps (C-Term)

N° du produit ABIN629628

Détail du produit anti-ZNF19 anticorps

Antigène: ZNF19 (Zinc Finger Protein 19 (ZNF19))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZNF19 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZNF19 antibody was raised against the C terminal of ZNF19

Purification: Purified

Immunogène: ZNF19 antibody was raised using the C terminal of ZNF19 corresponding to a region with amino acids HQHQRIHTGEKPYECSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLP

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZNF19 Blocking Peptide, catalog no. 33R-3824, is also available for use as a blocking control in assays to test for specificity of this ZNF19 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZNF19

Antigène: ZNF19 (Zinc Finger Protein 19 (ZNF19))

Autre désignation: ZNF19 (ZNF19 Produits)

Synonymes: anticorps KOX12, anticorps zinc finger protein 19, anticorps ZNF19

Sujet: ZNF19 contains a zinc finger, a nucleic acid-binding domain present in many transcription factors.

Poids moléculaire: 52 kDa (MW of target protein)