STRAP anticorps (C-Term)

N° du produit ABIN629629

Détail du produit anti-STRAP anticorps

Antigène: STRAP (Serine/threonine Kinase Receptor Associated Protein (STRAP))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STRAP est non-conjugé

Application: Western Blotting (WB)

Specificité: STRAP antibody was raised against the C terminal of STRAP

Purification: Purified

Immunogène: STRAP antibody was raised using the C terminal of STRAP corresponding to a region with amino acids ASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEEL

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STRAP Blocking Peptide, catalog no. 33R-1507, is also available for use as a blocking control in assays to test for specificity of this STRAP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STRAP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STRAP

Antigène: STRAP (Serine/threonine Kinase Receptor Associated Protein (STRAP))

Autre désignation: STRAP (STRAP Produits)

Synonymes: anticorps MAWD, anticorps PT-WD, anticorps UNRIP, anticorps zgc:56677, anticorps zgc:77604, anticorps mawd, anticorps pt-wd, anticorps unrip, anticorps AW557906, anticorps C78091, anticorps C79202, anticorps Unrip, anticorps serine/threonine kinase receptor associated protein, anticorps tetratricopeptide repeat domain 5, anticorps serine/threonine kinase receptor associated protein L homeolog, anticorps serine/threonine kinase receptor associated protein S homeolog, anticorps STRAP, anticorps TTC5, anticorps strap, anticorps strap.L, anticorps strap.S, anticorps Strap

Sujet: The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex.

Poids moléculaire: 38 kDa (MW of target protein)