WDR12 anticorps (C-Term)
-
- Antigène Voir toutes WDR12 Anticorps
- WDR12 (WD Repeat Domain 12 (WDR12))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp WDR12 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- WDR12 antibody was raised against the C terminal of WDR12
- Purification
- Purified
- Immunogène
- WDR12 antibody was raised using the C terminal of WDR12 corresponding to a region with amino acids DTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYRYSPTTSH
- Top Product
- Discover our top product WDR12 Anticorps primaire
-
anti-WD Repeat Domain 12 (WDR12) (AA 210-239) antibody
WDR12 Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal RB33036 unconjugated
anti-WD Repeat Domain 12 (WDR12) (C-Term) antibodyWDR12 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Cobaye, Cheval, Lapin, Chien, Poisson zèbre (Danio rerio) WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-WD Repeat Domain 12 (WDR12) (AA 1-280) antibodyWDR12 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-WD Repeat Domain 12 (WDR12) (C-Term) antibodyWDR12 Reactivité: Humain, Rat, Boeuf (Vache), Cobaye, Cheval, Lapin, Chien, Porc, Roussette (Chauve-souris), Hamster, Singe WB Hôte: Lapin Polyclonal unconjugated
anti-WD Repeat Domain 12 (WDR12) (AA 200-249) antibodyWDR12 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Cobaye, Cheval, Lapin, Porc, Poisson zèbre (Danio rerio), Roussette (Chauve-souris), Hamster, Singe WB Hôte: Lapin Polyclonal unconjugated
anti-WD Repeat Domain 12 (WDR12) (Middle Region) antibodyWDR12 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Cobaye, Cheval, Lapin, Chien, Poisson zèbre (Danio rerio), Saccharomyces cerevisiae WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
WDR12 Blocking Peptide, catalog no. 33R-2209, is also available for use as a blocking control in assays to test for specificity of this WDR12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- WDR12 (WD Repeat Domain 12 (WDR12))
- Autre désignation
- WDR12 (WDR12 Produits)
- Synonymes
- anticorps WDR12, anticorps YTM1, anticorps 4933402C23Rik, anticorps Ytm1, anticorps Ytm1p, anticorps fb24f09, anticorps wu:fb24f09, anticorps zgc:55609, anticorps WD repeat domain 12, anticorps WDR12, anticorps Wdr12, anticorps wdr12
- Sujet
- WDR12 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. The function of this protein is not known.
- Poids moléculaire
- 47 kDa (MW of target protein)
-
