CACYBP anticorps (Middle Region)

N° du produit ABIN629637

Détail du produit anti-CACYBP anticorps

Antigène: CACYBP (Calcyclin Binding Protein (CACYBP))

Épitope: Middle Region

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CACYBP est non-conjugé

Application: Western Blotting (WB)

Specificité: CACYBP antibody was raised against the middle region of CACYBP

Purification: Purified

Immunogène: CACYBP antibody was raised using the middle region of CACYBP corresponding to a region with amino acids FTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKK

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CACYBP Blocking Peptide, catalog no. 33R-3089, is also available for use as a blocking control in assays to test for specificity of this CACYBP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACYBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CACYBP

Antigène: CACYBP (Calcyclin Binding Protein (CACYBP))

Autre désignation: CACYBP (CACYBP Produits)

Synonymes: anticorps zgc:76993, anticorps CACYBP, anticorps sip, anticorps gig5, anticorps pnas-107, anticorps s100a6bp, anticorps T1P2.12, anticorps T1P2_12, anticorps GIG5, anticorps RP1-102G20.6, anticorps S100A6BP, anticorps SIP, anticorps calcyclin binding protein, anticorps calcyclin binding protein, putative, anticorps Calcyclin binding protein, putative, anticorps SGS domain-containing protein, anticorps calcyclin binding protein L homeolog, anticorps cacybp, anticorps CACYBP, anticorps PB000926.02.0, anticorps PCHAS_145490, anticorps PVX_100855, anticorps PKH_145680, anticorps AT1G30070, anticorps cacybp.L, anticorps Cacybp

Sujet: CACYBP is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin.

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus