WDR4 anticorps (C-Term)
-
- Antigène Voir toutes WDR4 Anticorps
- WDR4 (WD Repeat Domain 4 (WDR4))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp WDR4 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- WDR4 antibody was raised against the C terminal of WDR4
- Purification
- Purified
- Immunogène
- WDR4 antibody was raised using the C terminal of WDR4 corresponding to a region with amino acids AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA
- Top Product
- Discover our top product WDR4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
WDR4 Blocking Peptide, catalog no. 33R-1185, is also available for use as a blocking control in assays to test for specificity of this WDR4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- WDR4 (WD Repeat Domain 4 (WDR4))
- Autre désignation
- WDR4 (WDR4 Produits)
- Synonymes
- anticorps TRM82, anticorps TRMT82, anticorps AI415180, anticorps AI448349, anticorps D530049K22Rik, anticorps WD repeat domain 4, anticorps WD repeat domain 4 S homeolog, anticorps WDR4, anticorps Wdr4, anticorps wdr4.S
- Sujet
- WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
- Poids moléculaire
- 45 kDa (MW of target protein)
-