WDR4 anticorps (C-Term)

N° du produit ABIN629640

Détail du produit anti-WDR4 anticorps

Antigène: WDR4 (WD Repeat Domain 4 (WDR4))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDR4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: WDR4 antibody was raised against the C terminal of WDR4

Purification: Purified

Immunogène: WDR4 antibody was raised using the C terminal of WDR4 corresponding to a region with amino acids AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR4 Blocking Peptide, catalog no. 33R-1185, is also available for use as a blocking control in assays to test for specificity of this WDR4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDR4

Antigène: WDR4 (WD Repeat Domain 4 (WDR4))

Autre désignation: WDR4 (WDR4 Produits)

Synonymes: anticorps TRM82, anticorps TRMT82, anticorps AI415180, anticorps AI448349, anticorps D530049K22Rik, anticorps WD repeat domain 4, anticorps WD repeat domain 4 S homeolog, anticorps WDR4, anticorps Wdr4, anticorps wdr4.S

Sujet: WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.

Poids moléculaire: 45 kDa (MW of target protein)