ACTN2 anticorps (C-Term)
-
- Antigène Voir toutes ACTN2 Anticorps
- ACTN2 (Actinin, alpha 2 (ACTN2))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACTN2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- Alpha Actinin 2 antibody was raised against the C terminal of ACTN2
- Purification
- Purified
- Immunogène
- alpha Actinin 2 antibody was raised using the C terminal of ACTN2 corresponding to a region with amino acids VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD
- Top Product
- Discover our top product ACTN2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Alpha Actinin 2 Blocking Peptide, catalog no. 33R-9587, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
Force Generation via β-Cardiac Myosin, Titin, and α-Actinin Drives Cardiac Sarcomere Assembly from Cell-Matrix Adhesions." dans: Developmental cell, Vol. 44, Issue 1, pp. 87-96.e5, (2018) (PubMed).
: "
-
Force Generation via β-Cardiac Myosin, Titin, and α-Actinin Drives Cardiac Sarcomere Assembly from Cell-Matrix Adhesions." dans: Developmental cell, Vol. 44, Issue 1, pp. 87-96.e5, (2018) (PubMed).
-
- Antigène
- ACTN2 (Actinin, alpha 2 (ACTN2))
- Autre désignation
- alpha Actinin 2 (ACTN2 Produits)
- Sujet
- The alpha-actinins are a multigene family of four actin-binding proteins related to dystrophin. The two skeletal muscle isoforms of alpha-actinin (ACTN2 and ACTN3) are major structural components of the Z-line involved in anchoring the actin-containing thin filaments. In humans, ACTN2 is expressed in all muscle fibres, while ACTN3 expression is restricted to a subset of type 2 fibres. Murine Actn2 and Actn3 are differentially expressed, spatially and temporally, during embryonic development and, in contrast to humans, alpha-actinin-2 expression does not completely overlap alpha-actinin-3 in postnatal skeletal muscle, suggesting independent function.
- Poids moléculaire
- 98 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Skeletal Muscle Fiber Development, Negative Regulation of Transporter Activity
-