FAM107A anticorps (Middle Region)
-
- Antigène Voir toutes FAM107A Anticorps
- FAM107A (Family with Sequence Similarity 107, Member A (FAM107A))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FAM107A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FAM107 A antibody was raised against the middle region of FAM107
- Purification
- Purified
- Immunogène
- FAM107 A antibody was raised using the middle region of FAM107 corresponding to a region with amino acids RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE
- Top Product
- Discover our top product FAM107A Anticorps primaire
-
-
- Indications d'application
-
WB: 0.0625 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FAM107A Blocking Peptide, catalog no. 33R-8045, is also available for use as a blocking control in assays to test for specificity of this FAM107A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM100 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FAM107A (Family with Sequence Similarity 107, Member A (FAM107A))
- Autre désignation
- FAM107A (FAM107A Produits)
- Synonymes
- anticorps drr1, anticorps tu3a, anticorps xdrr1, anticorps DRR1, anticorps TU3A, anticorps Drr1, anticorps RGD1306327, anticorps Tu3a, anticorps family with sequence similarity 107 member A S homeolog, anticorps family with sequence similarity 107 member A, anticorps family with sequence similarity 107, member A, anticorps fam107a.S, anticorps FAM107A, anticorps Fam107a
- Sujet
- When FAM107A is transfected into cell lines in which it is not expressed, it suppresses cell growth. It may play a role in tumor development.
- Poids moléculaire
- 17 kDa (MW of target protein)
-