AKR1B1 anticorps
-
- Antigène Voir toutes AKR1B1 Anticorps
- AKR1B1 (Aldo-Keto Reductase Family 1, Member B1 (Aldose Reductase) (AKR1B1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AKR1B1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- AKR1 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI
- Top Product
- Discover our top product AKR1B1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AKR1B1 Blocking Peptide, catalog no. 33R-7728, is also available for use as a blocking control in assays to test for specificity of this AKR1B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKR0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- AKR1B1 (Aldo-Keto Reductase Family 1, Member B1 (Aldose Reductase) (AKR1B1))
- Autre désignation
- AKR1B1 (AKR1B1 Produits)
- Synonymes
- anticorps ADR, anticorps ALDR1, anticorps ALR2, anticorps AR, anticorps ALDRED, anticorps ALR-P-I, anticorps Akr1b3, anticorps Akr1b4, anticorps Aldr1, anticorps Alr, anticorps RATALDRED, anticorps akr1b7, anticorps zgc:86611, anticorps aldo-keto reductase family 1 member B, anticorps aldo-keto reductase family 1, member B1 (aldose reductase), anticorps aldo-keto reductase family 1, member B1 (aldose reductase) S homeolog, anticorps AKR1B1, anticorps Akr1b1, anticorps akr1b1.S, anticorps akr1b1
- Sujet
- AKR1B1 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol.
- Poids moléculaire
- 36 kDa (MW of target protein)
- Pathways
- Metabolism of Steroid Hormones and Vitamin D, C21-Steroid Hormone Metabolic Process, Monocarboxylic Acid Catabolic Process
-