PCMTD1 anticorps

N° du produit ABIN629648

Détail du produit anti-PCMTD1 anticorps

Antigène: PCMTD1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase Domain Containing 1 (PCMTD1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCMTD1 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: PCMTD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAVRNLQDLARIY

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCMTD1 Blocking Peptide, catalog no. 33R-9092, is also available for use as a blocking control in assays to test for specificity of this PCMTD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCMTD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCMTD1

Antigène: PCMTD1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase Domain Containing 1 (PCMTD1))

Autre désignation: PCMTD1 (PCMTD1 Produits)

Synonymes: anticorps fd15e12, anticorps wu:fd15e12, anticorps wu:fi15f10, anticorps zgc:123165, anticorps 8430411F12Rik, anticorps A030012M09Rik, anticorps RGD1307986, anticorps protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1, anticorps Protein-L-isoaspartate O-methyltransferase domain-containing protein 1, anticorps pcmtd1, anticorps pcmd1, anticorps PCMTD1, anticorps Pcmtd1

Sujet: The function of PCMTD1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 41 kDa (MW of target protein)