PPIA anticorps

N° du produit ABIN629650

Détail du produit anti-PPIA anticorps

Antigène: PPIA (Peptidylprolyl Isomerase A (Cyclophilin A) (PPIA))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPIA est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: PPIA antibody was raised using a synthetic peptide corresponding to a region with amino acids TAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPIA Blocking Peptide, catalog no. 33R-8977, is also available for use as a blocking control in assays to test for specificity of this PPIA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPIA

Antigène: PPIA (Peptidylprolyl Isomerase A (Cyclophilin A) (PPIA))

Autre désignation: PPIA (PPIA Produits)

Synonymes: anticorps Cyp1, anticorps PPIA-2, anticorps fa93g09, anticorps ppia, anticorps wu:fa93g09, anticorps wu:fb05e11, anticorps wu:fb13h02, anticorps wu:fb15a05, anticorps CYPA, anticorps CypA, anticorps Cypa, anticorps CYPH, anticorps CYCA, anticorps CyP-A, anticorps MGC75715, anticorps 2700098C05, anticorps Cphn, anticorps CyP-18, anticorps MT-ND1, anticorps MTND1, anticorps NADH1, anticorps ND1, anticorps cypA, anticorps PPIase A, anticorps ppial, anticorps wu:fj18g05, anticorps zgc:73102, anticorps zgc:86688, anticorps peptidylprolyl isomerase A, anticorps peptidylprolyl isomerase Aa (cyclophilin A), anticorps peptidylprolyl isomerase A (cyclophilin A) L homeolog, anticorps cyclophilin A, anticorps cyclophilin a, anticorps peptidylprolyl isomerase A (cyclophilin A), anticorps peptidylprolyl isomerase Ab (cyclophilin A), anticorps PPIA, anticorps ppiaa, anticorps ppia.L, anticorps Cypa, anticorps CNB01230, anticorps CNB01290, anticorps Tc00.1047053506925.300, anticorps Tb11.03.0250, anticorps CYPA, anticorps Ppia, anticorps ppia, anticorps ppiab

Sujet: PPIA is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. PPIA is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.

Poids moléculaire: 18 kDa (MW of target protein)