UPB1 anticorps (Middle Region)

N° du produit ABIN629651

Détail du produit anti-UPB1 anticorps

Antigène: UPB1 (Ureidopropionase, beta (UPB1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio), Drosophila melanogaster, Arabidopsis, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UPB1 est non-conjugé

Application: Western Blotting (WB)

Specificité: UPB1 antibody was raised against the middle region of UPB1

Purification: Purified

Immunogène: UPB1 antibody was raised using the middle region of UPB1 corresponding to a region with amino acids AVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAV

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UPB1 Blocking Peptide, catalog no. 33R-1619, is also available for use as a blocking control in assays to test for specificity of this UPB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UPB1

Antigène: UPB1 (Ureidopropionase, beta (UPB1))

Autre désignation: UPB1 (UPB1 Produits)

Synonymes: anticorps MGC82230, anticorps wu:fb69e03, anticorps zgc:64020, anticorps BUP1, anticorps AI195023, anticorps Bup1, anticorps ureidopropionase, beta S homeolog, anticorps beta-ureidopropionase 1, anticorps ureidopropionase, beta, anticorps UreidoPropionase Beta, anticorps upb1.S, anticorps UPB1, anticorps upb1, anticorps upb-1, anticorps Upb1

Sujet: UPB1 is a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta-aminoisobutyric acid, respectively. UP deficiencies are associated with N-carbamyl-beta-amino aciduria and may lead to abnormalities in neurological activity.

Poids moléculaire: 42 kDa (MW of target protein)