Liver Arginase anticorps (Arg1, N-Term)

N° du produit ABIN629657

Détail du produit anti-Liver Arginase anticorps

Antigène: Liver Arginase (ARG1) (Arginase, Liver (ARG1))

Épitope: Arg1, N-Term

Reactivité: Humain, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Liver Arginase est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: Arginase 1 antibody was raised against the N terminal of ARG1

Purification: Purified

Immunogène: Arginase 1 antibody was raised using the N terminal of ARG1 corresponding to a region with amino acids HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Arginase 1 Blocking Peptide, catalog no. 33R-3855, is also available for use as a blocking control in assays to test for specificity of this Arginase 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Liver Arginase

Antigène: Liver Arginase (ARG1) (Arginase, Liver (ARG1))

Autre désignation: Arginase 1 (ARG1 Produits)

Synonymes: anticorps SI:zC146F4.4 (novel protein with NUDIX domain), anticorps si:ch211-146f4.3, anticorps argi1, anticorps AI, anticorps AI256583, anticorps Arg-1, anticorps PGIF, anticorps arginase 1, anticorps arginase, anticorps Arginase-1, anticorps arginase, liver, anticorps L-arginase, anticorps arg1, anticorps PGTG_16455, anticorps argi1, anticorps ARG1, anticorps Arg1

Sujet: Arginase catalyzes the hydrolysis of arginine to ornithine and urea. The type I isoform of ARG1, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin