ALG1L6P anticorps (C-Term)

N° du produit ABIN629659

Détail du produit anti-ALG1L6P anticorps

Antigène: ALG1L6P (Asparagine-Linked Glycosylation 1 Homolog Pseudogene (ALG1L6P))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALG1L6P est non-conjugé

Application: Western Blotting (WB)

Specificité: LOC339879 antibody was raised against the C terminal of LOC339879

Purification: Purified

Immunogène: LOC339879 antibody was raised using the C terminal of LOC339879 corresponding to a region with amino acids HELVKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLQESQQL

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LOC339879 Blocking Peptide, catalog no. 33R-3720, is also available for use as a blocking control in assays to test for specificity of this LOC339879 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC339879 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALG1L6P

Antigène: ALG1L6P (Asparagine-Linked Glycosylation 1 Homolog Pseudogene (ALG1L6P))

Autre désignation: LOC339879 (ALG1L6P Produits)

Synonymes: anticorps asparagine-linked glycosylation 1-like 6, pseudogene, anticorps ALG1L6P

Sujet: The function of LOC339879 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 36 kDa (MW of target protein)