PDSS1 anticorps

N° du produit ABIN629662

Détail du produit anti-PDSS1 anticorps

Antigène: PDSS1 (Prenyl (Decaprenyl) Diphosphate Synthase, Subunit 1 (PDSS1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDSS1 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: PDSS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHE

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDSS1 Blocking Peptide, catalog no. 33R-3225, is also available for use as a blocking control in assays to test for specificity of this PDSS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDSS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDSS1

Antigène: PDSS1 (Prenyl (Decaprenyl) Diphosphate Synthase, Subunit 1 (PDSS1))

Autre désignation: PDSS1 (PDSS1 Produits)

Synonymes: anticorps COQ1, anticorps COQ10D2, anticorps DPS, anticorps RP13-16H11.3, anticorps SPS, anticorps TPRT, anticorps TPT, anticorps TPT 1, anticorps hDPS1, anticorps 2610203G20Rik, anticorps 2700031G06Rik, anticorps Tprt, anticorps mDLP1, anticorps mSPS1, anticorps tprt, anticorps wu:fc11f12, anticorps wu:fd05d05, anticorps zgc:112058, anticorps T30F21.15, anticorps T30F21_15, anticorps solanesyl diphosphate synthase 1, anticorps decaprenyl diphosphate synthase subunit 1, anticorps prenyl (solanesyl) diphosphate synthase, subunit 1, anticorps prenyl (decaprenyl) diphosphate synthase, subunit 1, anticorps solanesyl diphosphate synthase 1, anticorps PDSS1, anticorps Pdss1, anticorps pdss1, anticorps SPS1

Sujet: PDSS1 is an enzyme that elongates the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. PDSS1 catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. The protein may be peripherally associated with the inner mitochondrial membrane, though no transit peptide has been definitively identified to date. Defects in PDSS1 gene are a cause of coenzyme Q10 deficiency.

Poids moléculaire: 46 kDa (MW of target protein)