MDH2 anticorps
-
- Antigène Voir toutes MDH2 Anticorps
- MDH2 (Malate Dehydrogenase 2, NAD (Mitochondrial) (MDH2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MDH2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- MDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK
- Top Product
- Discover our top product MDH2 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MDH2 Blocking Peptide, catalog no. 33R-9388, is also available for use as a blocking control in assays to test for specificity of this MDH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MDH2 (Malate Dehydrogenase 2, NAD (Mitochondrial) (MDH2))
- Autre désignation
- MDH2 (MDH2 Produits)
- Synonymes
- anticorps Mdh2b, anticorps m-mdh, anticorps mdh2, anticorps mor1, anticorps MDH-2, anticorps Mdh, anticorps wu:fj48c08, anticorps wu:fj55d06, anticorps zgc:64133, anticorps M-MDH, anticorps MDH, anticorps MGC:3559, anticorps MOR1, anticorps MMDH, anticorps Mdh-2, anticorps Mor-1, anticorps Mor1, anticorps malate dehydrogenase 2 S homeolog, anticorps malate dehydrogenase 2, anticorps Malate dehydrogenase 2, anticorps malate dehydrogenase, anticorps malate dehydrogenase 2, NAD (mitochondrial), anticorps mdh2.S, anticorps MDH2, anticorps Mdh2, anticorps MDH4, anticorps mdh2
- Sujet
- Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH2 is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle.
- Poids moléculaire
- 33 kDa (MW of target protein)
-