MTHFD2 anticorps

N° du produit ABIN629664

Détail du produit anti-MTHFD2 anticorps

Antigène: MTHFD2 (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2, Methenyltetrahydrofolate Cyclohydrolase (MTHFD2))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MTHFD2 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: MTHFD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MTHFD2 Blocking Peptide, catalog no. 33R-5273, is also available for use as a blocking control in assays to test for specificity of this MTHFD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MTHFD2

Antigène: MTHFD2 (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2, Methenyltetrahydrofolate Cyclohydrolase (MTHFD2))

Autre désignation: MTHFD2 (MTHFD2 Produits)

Synonymes: anticorps nmdmc, anticorps AW558851, anticorps NMDMC, anticorps wu:fb38b11, anticorps wu:fe12e11, anticorps zgc:91891, anticorps methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase L homeolog, anticorps methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase, anticorps methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2 like S homeolog, anticorps methylenetetrahydrofolate dehydrogenase (NAD+ dependent), methenyltetrahydrofolate cyclohydrolase, anticorps mthfd2.L, anticorps MTHFD2, anticorps mthfd2, anticorps mthfd2l.S, anticorps Mthfd2

Sujet: MTHFD2 is a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD.

Poids moléculaire: 35 kDa (MW of target protein)