CKMT2 anticorps

N° du produit ABIN629666

Détail du produit anti-CKMT2 anticorps

Antigène: CKMT2 (Creatine Kinase, Mitochondrial 2 (Sarcomeric) (CKMT2))

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CKMT2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: CKMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPA

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CKMT2 Blocking Peptide, catalog no. 33R-3621, is also available for use as a blocking control in assays to test for specificity of this CKMT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CKMT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CKMT2

Antigène: CKMT2 (Creatine Kinase, Mitochondrial 2 (Sarcomeric) (CKMT2))

Autre désignation: CKMT2 (CKMT2 Produits)

Synonymes: anticorps 2300008A19Rik, anticorps ScCKmit, anticorps MIBCK, anticorps SMTCK, anticorps ckmt2-2, anticorps zgc:73059, anticorps CKMT2, anticorps Mib-CK, anticorps S-MtCK, anticorps creatine kinase, mitochondrial 2, anticorps creatine kinase, mitochondrial 2 (sarcomeric), anticorps creatine kinase, mitochondrial 2b (sarcomeric), anticorps CKMT2, anticorps ckmt2, anticorps Ckmt2, anticorps ckmt2b

Sujet: Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes.

Poids moléculaire: 46 kDa (MW of target protein)