S100A3 anticorps (N-Term)

N° du produit ABIN629669

Détail du produit anti-S100A3 anticorps

Antigène: S100A3 (S100 Calcium Binding Protein A3 (S100A3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp S100A3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: S100 A3 antibody was raised against the N terminal of S100 3

Purification: Purified

Immunogène: S100 A3 antibody was raised using the N terminal of S100 3 corresponding to a region with amino acids MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEF

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

S100A3 Blocking Peptide, catalog no. 33R-5733, is also available for use as a blocking control in assays to test for specificity of this S100A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of S100 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur S100A3

Antigène: S100A3 (S100 Calcium Binding Protein A3 (S100A3))

Autre désignation: S100A3 (S100A3 Produits)

Synonymes: anticorps S100E, anticorps S100 calcium binding protein A3, anticorps S100A3, anticorps S100a3

Sujet: S100A3 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown.

Poids moléculaire: 11 kDa (MW of target protein)

Pathways: S100 Proteins