NFS1 anticorps
-
- Antigène Voir toutes NFS1 Anticorps
- NFS1 (NFS1, Cysteine Desulfurase (NFS1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NFS1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- NFS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV
- Top Product
- Discover our top product NFS1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.3125 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NFS1 Blocking Peptide, catalog no. 33R-9331, is also available for use as a blocking control in assays to test for specificity of this NFS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NFS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NFS1 (NFS1, Cysteine Desulfurase (NFS1))
- Autre désignation
- NFS1 (NFS1 Produits)
- Synonymes
- anticorps ARABIDOPSIS THALIANA NITROGEN FIXATION S (NIFS)-LIKE 1, anticorps ATNFS1, anticorps ATNIFS1, anticorps CYSTEINE DESULFURASE, anticorps MPA24.7, anticorps MPA24_7, anticorps NIFS1, anticorps NITROGEN FIXATION S HOMOLOG 1, anticorps nitrogen fixation S (NIFS)-like 1, anticorps IscS, anticorps NIFS, anticorps Nifs, anticorps NFS1, anticorps AA987187, anticorps m-Nfs1, anticorps m-Nfsl, anticorps fb50g03, anticorps wu:fb50g03, anticorps aminotransferase family protein (LolT), anticorps cysteine desulfurase, (m-Nfs1), anticorps nitrogen fixation S (NIFS)-like 1, anticorps cysteine desulfurase, anticorps NFS1, cysteine desulfurase, anticorps NFS1 cysteine desulfurase, anticorps nitrogen fixation gene 1 (S. cerevisiae), anticorps AOR_1_546014, anticorps trd_A0109, anticorps NFS1, anticorps Arnit_0871, anticorps Fbal_3329, anticorps Nfs1, anticorps nfs1
- Sujet
- Iron-sulfur clusters are required for the function of many cellular enzymes. The protein encoded by this geneupplies inorganic sulfur to these clusters by removing the sulfur from cysteine, creating alanine in the process. This gene uses alternate in-frame translation initiation sites to generate mitochondrial forms and cytoplasmic/nuclear forms. Selection of the alternative initiation sites is determined by the cytosolic pH.
- Poids moléculaire
- 50 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-