ATP5B anticorps (C-Term)
-
- Antigène Voir toutes ATP5B Anticorps
- ATP5B (ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, beta Polypeptide (ATP5B))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ATP5B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ATP5 B antibody was raised against the C terminal of ATP5
- Purification
- Purified
- Immunogène
- ATP5 B antibody was raised using the C terminal of ATP5 corresponding to a region with amino acids MGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEH
- Top Product
- Discover our top product ATP5B Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ATP5B Blocking Peptide, catalog no. 33R-6043, is also available for use as a blocking control in assays to test for specificity of this ATP5B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ATP5B (ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, beta Polypeptide (ATP5B))
- Autre désignation
- ATP5B (ATP5B Produits)
- Synonymes
- anticorps atpmb, anticorps atpsb, anticorps Atpsyn-beta, anticorps hm:zehn0534, anticorps im:6793121, anticorps wu:fj38d01, anticorps zgc:111961, anticorps ATPMB, anticorps ATPSB, anticorps ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide, anticorps ATP synthase subunit beta, mitochondrial, anticorps ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit, anticorps ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide S homeolog, anticorps ATP5B, anticorps atp5b, anticorps Atp5b, anticorps LOC100401662, anticorps LOC100635763, anticorps atp5b.S
- Sujet
- ATP5B is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). ATP5B is the beta subunit of the catalytic core.
- Poids moléculaire
- 52 kDa (MW of target protein)
- Pathways
- Proton Transport, Ribonucleoside Biosynthetic Process
-