ECH1 anticorps (N-Term)
-
- Antigène Voir toutes ECH1 Anticorps
- ECH1 (Enoyl Coenzyme A Hydratase 1, Peroxisomal (ECH1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ECH1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ECH1 antibody was raised against the N terminal of ECH1
- Purification
- Purified
- Immunogène
- ECH1 antibody was raised using the N terminal of ECH1 corresponding to a region with amino acids PDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDA
- Top Product
- Discover our top product ECH1 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ECH1 Blocking Peptide, catalog no. 33R-7014, is also available for use as a blocking control in assays to test for specificity of this ECH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ECH1 (Enoyl Coenzyme A Hydratase 1, Peroxisomal (ECH1))
- Autre désignation
- ECH1 (ECH1 Produits)
- Sujet
- ECH1 is a member of the hydratase/isomerase superfamily. ECH1 shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The protein contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway.
- Poids moléculaire
- 36 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-