ALDH4A1 anticorps (N-Term)

N° du produit ABIN629678

Détail du produit anti-ALDH4A1 anticorps

Antigène: ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALDH4A1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: ALDH4 A1 antibody was raised against the N terminal of ALDH4 1

Purification: Purified

Immunogène: ALDH4 A1 antibody was raised using the N terminal of ALDH4 1 corresponding to a region with amino acids QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGL

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALDH4A1 Blocking Peptide, catalog no. 33R-7563, is also available for use as a blocking control in assays to test for specificity of this ALDH4A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALDH4A1

Antigène: ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))

Autre désignation: ALDH4A1 (ALDH4A1 Produits)

Synonymes: anticorps aldh4, anticorps p5cd, anticorps p5cdh, anticorps ALDH4, anticorps P5CD, anticorps P5CDh, anticorps A930035F14Rik, anticorps Ahd-1, anticorps Ahd1, anticorps Aldh4, anticorps Aldh5a1, anticorps E330022C09, anticorps P5cd, anticorps P5cdh, anticorps P5cdhl, anticorps P5cdhs, anticorps Ssdh1, anticorps zgc:63592, anticorps aldehyde dehydrogenase 4 family member A1, anticorps aldehyde dehydrogenase 4 family, member A1, anticorps aldehyde dehydrogenase 4 family member A1 L homeolog, anticorps aldh4a1, anticorps ALDH4A1, anticorps Aldh4a1, anticorps aldh4a1.L

Sujet: ALDH4A1 belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process