ALDH4A1 anticorps (C-Term)
-
- Antigène Voir toutes ALDH4A1 Anticorps
- ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Chien, Poisson zèbre (Danio rerio)
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ALDH4A1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- ALDH4 A1 antibody was raised against the C terminal of ALDH4 1
- Purification
- Purified
- Immunogène
- ALDH4 A1 antibody was raised using the C terminal of ALDH4 1 corresponding to a region with amino acids RNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVI
- Top Product
- Discover our top product ALDH4A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ALDH4A1 Blocking Peptide, catalog no. 33R-8071, is also available for use as a blocking control in assays to test for specificity of this ALDH4A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))
- Autre désignation
- ALDH4A1 (ALDH4A1 Produits)
- Synonymes
- anticorps aldh4, anticorps p5cd, anticorps p5cdh, anticorps ALDH4, anticorps P5CD, anticorps P5CDh, anticorps A930035F14Rik, anticorps Ahd-1, anticorps Ahd1, anticorps Aldh4, anticorps Aldh5a1, anticorps E330022C09, anticorps P5cd, anticorps P5cdh, anticorps P5cdhl, anticorps P5cdhs, anticorps Ssdh1, anticorps zgc:63592, anticorps aldehyde dehydrogenase 4 family member A1, anticorps aldehyde dehydrogenase 4 family, member A1, anticorps aldehyde dehydrogenase 4 family member A1 L homeolog, anticorps aldh4a1, anticorps ALDH4A1, anticorps Aldh4a1, anticorps aldh4a1.L
- Sujet
- ALDH4A1 belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline.
- Poids moléculaire
- 62 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-