CROT anticorps (N-Term)
-
- Antigène Voir toutes CROT Anticorps
- CROT (Carnitine O-Octanoyltransferase (CROT))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CROT est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CROT antibody was raised against the N terminal of CROT
- Purification
- Purified
- Immunogène
- CROT antibody was raised using the N terminal of CROT corresponding to a region with amino acids MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKK
- Top Product
- Discover our top product CROT Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CROT Blocking Peptide, catalog no. 33R-5938, is also available for use as a blocking control in assays to test for specificity of this CROT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CROT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CROT (Carnitine O-Octanoyltransferase (CROT))
- Autre désignation
- CROT (CROT Produits)
- Synonymes
- anticorps CROT, anticorps cot, anticorps zgc:110643, anticorps COT, anticorps 1200003H03Rik, anticorps carnitine O-octanoyltransferase, anticorps CROT, anticorps crot, anticorps Crot
- Sujet
- Carnitine octanoyltransferase is a carnitine acyltransferase that catalyzes the reversible transfer of fatty acyl groups between CoA and carnitine. This provides a crucial step in the transport of medium- and long-chain acyl-CoA out of the mammalian peroxisome to the cytosol and mitochondria.
- Poids moléculaire
- 70 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-