OTC anticorps (N-Term)

N° du produit ABIN629690

Détail du produit anti-OTC anticorps

Antigène: OTC (Ornithine Carbamoyltransferase (OTC))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OTC est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: OTC antibody was raised against the N terminal of OTC

Purification: Purified

Immunogène: OTC antibody was raised using the N terminal of OTC corresponding to a region with amino acids AFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSAD

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OTC Blocking Peptide, catalog no. 33R-1173, is also available for use as a blocking control in assays to test for specificity of this OTC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OTC

Antigène: OTC (Ornithine Carbamoyltransferase (OTC))

Autre désignation: OTC (OTC Produits)

Synonymes: anticorps OCTD, anticorps 2810428A13Rik, anticorps AA589422, anticorps AW457381, anticorps OCT, anticorps Plxn2, anticorps mKIAA0463, anticorps F1B16.13, anticorps F1B16_13, anticorps ORNITHINE CARBAMOYLTRANSFERASE, anticorps ornithine carbamoyltransferase, anticorps BA4351, anticorps PSPTO4164, anticorps PLXN2, anticorps AI265390, anticorps Sf, anticorps spf, anticorps si:dkey-19h21.3, anticorps ornithine carbamoyltransferase, anticorps plexin A2, anticorps ornithine carbamoyltransferase ArgF, anticorps ornithine transcarbamylase, anticorps OTC, anticorps Plxna2, anticorps Otc, anticorps argF, anticorps argF-2, anticorps atpD-2, anticorps CNC04300, anticorps PLXNA2, anticorps otc

Sujet: OTC is a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may play a role in that disease also.

Poids moléculaire: 39 kDa (MW of target protein)